Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIP Rabbit Polyclonal Antibody (FITC)

AIP Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e

UniProt

O08915

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enoph1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
19301114 3x 1.0 µg

Enoph1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
YPEL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV681493 1.0 µg DNA

YPEL4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
BDKRB1 Protein Vector (Rat) (pPB-N-His)
PV256115 500 ng

BDKRB1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Human Pulmonary surfactant-associated protein A1 ELISA Kit
EK2413 Inquire

Human Pulmonary surfactant-associated protein A1 ELISA Kit

Sign In for Pricing
View Details
Canine Angiopoietin Like Protein 2 ELISA Kit
MBS028447-01 48 Well

Canine Angiopoietin Like Protein 2 ELISA Kit

Sign In for Pricing
View Details
Canine Angiopoietin Like Protein 2 ELISA Kit
MBS028447-02 96 Well

Canine Angiopoietin Like Protein 2 ELISA Kit

Sign In for Pricing
View Details