Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIP Rabbit Polyclonal Antibody (HRP)

AIP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e

UniProt

O08915

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hsp90 beta Rabbit Monoclonal Antibody
MA3145-.1 100 µL

Anti-Hsp90 beta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
OR2T5, NT (OR2T5, Olfactory receptor 2T5, Olfactory receptor OR1-62) (MaxLight 405) discontinued
039372-ML405 100 µL

OR2T5, NT (OR2T5, Olfactory receptor 2T5, Olfactory receptor OR1-62) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Propoxycaine-d4 Hydrochloride
463085 1 mg

Propoxycaine-d4 Hydrochloride

Sign In for Pricing
View Details
PRSS21 Polyclonal Antibody
orb616915-01 50 μL

PRSS21 Polyclonal Antibody

Sign In for Pricing
View Details
PRSS21 Polyclonal Antibody
orb616915-02 100 µL

PRSS21 Polyclonal Antibody

Sign In for Pricing
View Details
GPR120 (G-protein Coupled Receptor 120, G-protein Coupled Receptor 129, G-protein Coupled Receptor GT01, G-protein Coupled Receptor PGR4, Omega-3 Fatty Acid Receptor 1, GPR120, GPR129, O3FAR1, PGR4)
151494 100 µg

GPR120 (G-protein Coupled Receptor 120, G-protein Coupled Receptor 129, G-protein Coupled Receptor GT01, G-protein Coupled Receptor PGR4, Omega-3 Fatty Acid Receptor 1, GPR120, GPR129, O3FAR1, PGR4)

Sign In for Pricing
View Details