Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIP Rabbit Polyclonal Antibody (HRP)

AIP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e

UniProt

O08915

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM215 Recombinant Protein (Mouse)
RP179630 100 µg

TMEM215 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human PYCR1 (Pyrroline-5-carboxylate reductase 1, mitochondrial) Quick ELISA Kit
orb2568374-01 48 Tests

Human PYCR1 (Pyrroline-5-carboxylate reductase 1, mitochondrial) Quick ELISA Kit

Sign In for Pricing
View Details
Human PYCR1 (Pyrroline-5-carboxylate reductase 1, mitochondrial) Quick ELISA Kit
orb2568374-02 96 Tests

Human PYCR1 (Pyrroline-5-carboxylate reductase 1, mitochondrial) Quick ELISA Kit

Sign In for Pricing
View Details
BOP1 Rabbit Polyclonal Antibody (FITC)
orb2117049 100 µL

BOP1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Anti-CDC14C Antibody
CTA1643-01 30 µL

Anti-CDC14C Antibody

Sign In for Pricing
View Details
Anti-CDC14C Antibody
CTA1643-02 50 μL

Anti-CDC14C Antibody

Sign In for Pricing
View Details