Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIP Rabbit Polyclonal Antibody (Biotin)

AIP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, Xa, Ara9, Xap2, Fkbp1, Fkbp16, AA408703, AW476050, D19Bwg1412e

UniProt

O08915

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: REDGIQKRVIQEGRGELPDFQDGTKATFHFRTLHSDNEGSVIDDSRTRGK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057875

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Blood Group Ok(a) (MaxLight 405)
MBS6245040-01 0.1 mL

Blood Group Ok(a) (MaxLight 405)

Sign In for Pricing
View Details
Blood Group Ok(a) (MaxLight 405)
MBS6245040-02 5x 0.1 mL

Blood Group Ok(a) (MaxLight 405)

Sign In for Pricing
View Details
Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS) (100)
GTR15301509 1 Vial

Lentiviral mouse Rhpn1 shRNA (UAS) - Lentiviral mouse Rhpn1 shRNA (UAS) (100)

Sign In for Pricing
View Details
Human Anti-carbamylated-FCS ELISA Kit
MBS7253929-01 48 Well

Human Anti-carbamylated-FCS ELISA Kit

Sign In for Pricing
View Details
Human Anti-carbamylated-FCS ELISA Kit
MBS7253929-02 96 Well

Human Anti-carbamylated-FCS ELISA Kit

Sign In for Pricing
View Details
Human Anti-carbamylated-FCS ELISA Kit
MBS7253929-03 5x 96 Well

Human Anti-carbamylated-FCS ELISA Kit

Sign In for Pricing
View Details