Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mybbp1a Rabbit Polyclonal Antibody (FITC)

Mybbp1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902

UniProt

O35821

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Mybbp1a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_058056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-01 96 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-02 48 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
USP21 (NM_001014443) Human Over-expression Lysate
LY423066 100 µg

USP21 (NM_001014443) Human Over-expression Lysate

Sign In for Pricing
View Details
Dynein (DYNLL2) Rabbit Polyclonal Antibody
TA369517 100 µL

Dynein (DYNLL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Peripherin Chicken Polyclonal Antibody
AP31818PU-N 200 µL

Peripherin Chicken Polyclonal Antibody

Sign In for Pricing
View Details
Mitochondrial Marker (113-1), Biotin conjugate, 0.1mg/mL
BNCB0739-500 1x 500 µL

Mitochondrial Marker (113-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details