Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902

UniProt

O35821

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Mybbp1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_058056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV2-CMV-PHLDA2-HA-Puro Plasmid
PVT82349 2 µg

PLV2-CMV-PHLDA2-HA-Puro Plasmid

Sign In for Pricing
View Details
Phospho-VASP (Ser239) Antibody [N1M20]
F2659-100uL 100 µL

Phospho-VASP (Ser239) Antibody [N1M20]

Sign In for Pricing
View Details
Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)
abx344780-01 20 µg

Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)

Sign In for Pricing
View Details
Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)
abx344780-02 50 µg

Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)

Sign In for Pricing
View Details
Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)
abx344780-03 100 µg

Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)

Sign In for Pricing
View Details
Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)
abx344780-04 200 µg

Tumor suppressor candidate 3 (TUSC3) Antibody (Biotin)

Sign In for Pricing
View Details