Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Mybbp1a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P160, p67M, p160M, p67MBP, p160MBP, AL024407, AU019902

UniProt

O35821

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Mybbp1a

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKKNAKDIPSDTQSPVSTKRKKKGFLPETKKRKKLKSEGTTPEKNAASQQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_058056

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr390 Protein Lysate (Mouse) with C-HA Tag
33120034 100 µg

Olfr390 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-Zebrafish LHX3 Antibody Picoband® Fluoro647 Conjugated
AZQ90421-Fluoro647 100 µg/Vial

Anti-Zebrafish LHX3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Epac1 Rabbit Polyclonal Antibody (BF350)
orb2381532 100 µL

Epac1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)
MBS2078739-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)
MBS2078739-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)
MBS2078739-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Ankyrin Repeat Domain Protein 1 (ANKRD1)

Sign In for Pricing
View Details