Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEF Rabbit Polyclonal Antibody (FITC)

TEF Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

2310028D20Rik

UniProt

Q9JLC6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse TEF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPPRETRL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_059072

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP12, CT (Macrophage Metalloelastase, MME, Matrix Metalloproteinase-12, MMP-12, Macrophage Elastase, ME, hME, HME) (APC)
MBS6487063-01 0.2 mL

MMP12, CT (Macrophage Metalloelastase, MME, Matrix Metalloproteinase-12, MMP-12, Macrophage Elastase, ME, hME, HME) (APC)

Sign In for Pricing
View Details
MMP12, CT (Macrophage Metalloelastase, MME, Matrix Metalloproteinase-12, MMP-12, Macrophage Elastase, ME, hME, HME) (APC)
MBS6487063-02 5x 0.2 mL

MMP12, CT (Macrophage Metalloelastase, MME, Matrix Metalloproteinase-12, MMP-12, Macrophage Elastase, ME, hME, HME) (APC)

Sign In for Pricing
View Details
RBM14, ID (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (PE)
MBS6498004-01 0.2 mL

RBM14, ID (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (PE)

Sign In for Pricing
View Details
RBM14, ID (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (PE)
MBS6498004-02 5x 0.2 mL

RBM14, ID (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (PE)

Sign In for Pricing
View Details
PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (APC)
250230-APC 100 µL

PLP1 (Proteolipid Protein 1, HLD1, MMPL, PLP, PLP/DM20, PMD, SPG2) (APC)

Sign In for Pricing
View Details
Sheep T Cell B Cell Activating Molecule Polyclonal Antibody ELISA Kit
MBS015374-01 48 Well

Sheep T Cell B Cell Activating Molecule Polyclonal Antibody ELISA Kit

Sign In for Pricing
View Details