Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptf1a Rabbit Polyclonal Antibody (FITC)

Ptf1a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BHLHa, PTF1-p, PTF1p48, bHLHa29, PTF1-p48

UniProt

Q9QX98

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ptf1a

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_061279

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Free Thyroxine, FT4 ELISA Kit
orb1675712 96 Tests

Mouse Free Thyroxine, FT4 ELISA Kit

Sign In for Pricing
View Details
GSTO1, ID (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 750) discontinued
G8135-21D-ML750 100 µL

GSTO1, ID (Glutathione S-transferase omega-1, GSTO 1-1, GSTTLP28) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (MaxLight 405)
MBS6395031-01 0.1 mL

SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (MaxLight 405)

Sign In for Pricing
View Details
SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (MaxLight 405)
MBS6395031-02 5x 0.1 mL

SPSB2 (SPRY Domain-containing SOCS Box Protein 2, SSB2, SSB-2, Gene-rich Cluster Protein C9, GRCC9) (MaxLight 405)

Sign In for Pricing
View Details
EB-1 (1A11/4) Mouse Monoclonal Antibody
CST 2164T 20 µL

EB-1 (1A11/4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
NFκB-p105(Phospho-Ser927) Polyclonal Conjugated Antibody
C11312 100 µL

NFκB-p105(Phospho-Ser927) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details