Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX21 Rabbit Polyclonal Antibody (FITC)

TBX21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TBT1, Tbet, Tbly, Tblym

UniProt

Q9JKD8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TBX21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_062380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanylate Cyclase beta-1, Soluble (GCS-beta-1, GC-S-beta-1, GUCY1B1, Guanylate Cyclase 1 Soluble beta 3, GUC1B3, GUCY1B3, Guanylate Cyclase Soluble Subunit beta-3, GCS-beta-3, GC-SB3, GUCB3, GUCSB3, Soluble Guanylate Cyclase Small Subunit) (PE) discontinued
G9804-50-PE 100 µL

Guanylate Cyclase beta-1, Soluble (GCS-beta-1, GC-S-beta-1, GUCY1B1, Guanylate Cyclase 1 Soluble beta 3, GUC1B3, GUCY1B3, Guanylate Cyclase Soluble Subunit beta-3, GCS-beta-3, GC-SB3, GUCB3, GUCSB3, Soluble Guanylate Cyclase Small Subunit) (PE) discontinued

Sign In for Pricing
View Details
CLDN14 (Claudin-14, UNQ777/PRO1571) (MaxLight 650)
MBS6374068-01 0.1 mL

CLDN14 (Claudin-14, UNQ777/PRO1571) (MaxLight 650)

Sign In for Pricing
View Details
CLDN14 (Claudin-14, UNQ777/PRO1571) (MaxLight 650)
MBS6374068-02 5x 0.1 mL

CLDN14 (Claudin-14, UNQ777/PRO1571) (MaxLight 650)

Sign In for Pricing
View Details
Sortilin (SORT1) Rat ELISA Kit
H2324 96 Tests

Sortilin (SORT1) Rat ELISA Kit

Sign In for Pricing
View Details
Human GPR115 Alexa Fluor 647 MAb (Clone 527018)
FAB54371R-100UG 100 µg

Human GPR115 Alexa Fluor 647 MAb (Clone 527018)

Sign In for Pricing
View Details
Compound NP-012815
T129952-01 10 mg

Compound NP-012815

Sign In for Pricing
View Details