Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX21 Rabbit Polyclonal Antibody (HRP)

TBX21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TBT1, Tbet, Tbly, Tblym

UniProt

Q9JKD8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TBX21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_062380

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM38B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0721805 3x 1.0 µg

FAM38B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TIPRL Protein Vector (Mouse) (pPM-C-His)
PV238461 500 ng

TIPRL Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LSM14B CRISPRa sgRNA lentivector (set of three targets)(Human)
27744121 3x 1.0µg DNA

LSM14B CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Human Ephrin A2 (EFNA2) ELISA Kit
MBS2024728-01 24 Strip Well

Human Ephrin A2 (EFNA2) ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A2 (EFNA2) ELISA Kit
MBS2024728-02 48 Well

Human Ephrin A2 (EFNA2) ELISA Kit

Sign In for Pricing
View Details
Human Ephrin A2 (EFNA2) ELISA Kit
MBS2024728-03 96 Well

Human Ephrin A2 (EFNA2) ELISA Kit

Sign In for Pricing
View Details