Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CITED4 Rabbit Polyclonal Antibody (FITC)

CITED4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mrg, Mrg2, MRG-2

UniProt

Q9WUL8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_062509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 and Influenza A+B Antigen Combo Rapid Test Device-Swab
D-COVISD20 20 Tests

SARS-CoV-2 and Influenza A+B Antigen Combo Rapid Test Device-Swab

Sign In for Pricing
View Details
Olfactory Receptor 9A2
326872-01 50 µg

Olfactory Receptor 9A2

Sign In for Pricing
View Details
Olfactory Receptor 9A2
326872-02 100 µg

Olfactory Receptor 9A2

Sign In for Pricing
View Details
RNF144B, ID (RNF144B, IBRDC2, P53RFP, E3 ubiquitin-protein ligase RNF144B, IBR domain-containing protein 2, RING finger protein 144B, p53-inducible RING finger protein) (MaxLight 550)
MBS6342628-01 0.1 mL

RNF144B, ID (RNF144B, IBRDC2, P53RFP, E3 ubiquitin-protein ligase RNF144B, IBR domain-containing protein 2, RING finger protein 144B, p53-inducible RING finger protein) (MaxLight 550)

Sign In for Pricing
View Details
RNF144B, ID (RNF144B, IBRDC2, P53RFP, E3 ubiquitin-protein ligase RNF144B, IBR domain-containing protein 2, RING finger protein 144B, p53-inducible RING finger protein) (MaxLight 550)
MBS6342628-02 5x 0.1 mL

RNF144B, ID (RNF144B, IBRDC2, P53RFP, E3 ubiquitin-protein ligase RNF144B, IBR domain-containing protein 2, RING finger protein 144B, p53-inducible RING finger protein) (MaxLight 550)

Sign In for Pricing
View Details
Human O-GlcNAc Transferase (OGT) ELISA Kit
SL4745Hu-01 48 Tests

Human O-GlcNAc Transferase (OGT) ELISA Kit

Sign In for Pricing
View Details