Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CITED4 Rabbit Polyclonal Antibody (HRP)

CITED4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mrg, Mrg2, MRG-2

UniProt

Q9WUL8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_062509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ICAM-1/CD54 Antibody (15.2) [PE/Cy7]
NBP2-50431PECY7 0.1 mL

Mouse Monoclonal ICAM-1/CD54 Antibody (15.2) [PE/Cy7]

Sign In for Pricing
View Details
TBX21 Recombinant Antibody, PerCP Conjugated
bsm-62988R-PerCP 100 µL

TBX21 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Laminin-R CRISPR Activation Plasmid (h)
sc-417155-ACT 20 µg

Laminin-R CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
KNG1 Protein Vector (Rat) (pPM-C-His)
PV276665 500 ng

KNG1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
DNAJC4 3'UTR Lenti-reporter-Luc Vector
18413081 1.0 µg

DNAJC4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit
orb780599-01 48 Tests

Rat Secreted Frizzled Related Protein 2 (SFRP2) ELISA Kit

Sign In for Pricing
View Details