Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pus1 Rabbit Polyclonal Antibody (Biotin)

Pus1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MPU, MPUS1, mPus1p, A730013B20Rik

UniProt

Q791J1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGWVWEETEHPAKRVKGGEDEEPPRKLPKRKIVLLMAYSGKGYHGMQRNL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 (LINGO3)
MBS958952 Inquire

Recombinant Human Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 (LINGO3)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae pilE1 Protein (aa 8-180)
VAng-Wyb2270-1mgEcoli 1 mg (E. coli)

Recombinant Neisseria Gonorrhoeae pilE1 Protein (aa 8-180)

Sign In for Pricing
View Details
A-498 Cell Line
CL-0254 1x 10^6 Cells/Vial - 2 Vials

A-498 Cell Line

Sign In for Pricing
View Details
Lentiviral human NT5C2 shRNA (UAS) - Lentiviral human NT5C2 shRNA (UAS) (25)
GTR15138833 1 Vial

Lentiviral human NT5C2 shRNA (UAS) - Lentiviral human NT5C2 shRNA (UAS) (25)

Sign In for Pricing
View Details
BCL2 Antibody
orb388610-01 20 µg

BCL2 Antibody

Sign In for Pricing
View Details
BCL2 Antibody
orb388610-02 100 µg

BCL2 Antibody

Sign In for Pricing
View Details