Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX3 Rabbit Polyclonal Antibody (Biotin)

RUNX3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AM, Rx, Rx3, AML2, Cbfa, Cbfa3, Pebp2a3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse RUNX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TKD Peptide (Hsp70 Peptide)
B2018995 1 mg

TKD Peptide (Hsp70 Peptide)

Sign In for Pricing
View Details
DNTT Rabbit Polyclonal Antibody (BF750)
orb1588591 100 µL

DNTT Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
TNNI1 (Troponin I Type 1, Slow Skeletal, TNN1, SSTNI) discontinued
213861-01 20 µL

TNNI1 (Troponin I Type 1, Slow Skeletal, TNN1, SSTNI) discontinued

Sign In for Pricing
View Details
TNNI1 (Troponin I Type 1, Slow Skeletal, TNN1, SSTNI) discontinued
213861-02 100 µL

TNNI1 (Troponin I Type 1, Slow Skeletal, TNN1, SSTNI) discontinued

Sign In for Pricing
View Details
GFP hsa-mir-562 AAV miRNA Vector
Amh1087500 500 ng

GFP hsa-mir-562 AAV miRNA Vector

Sign In for Pricing
View Details
Rat Neudesin (NENF) ELISA Kit
abx556206 96 Tests

Rat Neudesin (NENF) ELISA Kit

Sign In for Pricing
View Details