Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX3 Rabbit Polyclonal Antibody (Biotin)

RUNX3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AM, Rx, Rx3, AML2, Cbfa, Cbfa3, Pebp2a3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse RUNX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PYPGAPQSQSGPFQANPAPYHLFYGASSGSYQFSMAAAGGGERSPTRMLT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7,8-Dihydroquinolin-5 (6H) -one
OR17531-01 250 mg

7,8-Dihydroquinolin-5 (6H) -one

Sign In for Pricing
View Details
7,8-Dihydroquinolin-5 (6H) -one
OR17531-02 5 g

7,8-Dihydroquinolin-5 (6H) -one

Sign In for Pricing
View Details
CLTA AAV siRNA Pooled Vector
16386161 1.0 µg

CLTA AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human GSTα5 (Glutathione S Transferase Alpha 5) ELISA Kit
RE1769H-01 48 Tests

Human GSTα5 (Glutathione S Transferase Alpha 5) ELISA Kit

Sign In for Pricing
View Details
Human GSTα5 (Glutathione S Transferase Alpha 5) ELISA Kit
RE1769H-02 96 Tests

Human GSTα5 (Glutathione S Transferase Alpha 5) ELISA Kit

Sign In for Pricing
View Details
ABCA13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0017807 1.0 µg DNA

ABCA13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details