Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ascl3 Rabbit Polyclonal Antibody (HRP)

Ascl3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sg, Sgn1, bHLHa, bHLHa42

UniProt

Q9JJR7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Ascl3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_064435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IRF4 qPCR Primer Pair
QH03837S 200 Tests

Human IRF4 qPCR Primer Pair

Sign In for Pricing
View Details
RAI14 siRNA (Human)
CRH8692-01 15 nmol

RAI14 siRNA (Human)

Sign In for Pricing
View Details
RAI14 siRNA (Human)
CRH8692-02 30 nmol

RAI14 siRNA (Human)

Sign In for Pricing
View Details
Prkca, NT (Prkca, Pkca, Protein kinase C alpha type) (MaxLight 405)
MBS6337308-01 0.1 mL

Prkca, NT (Prkca, Pkca, Protein kinase C alpha type) (MaxLight 405)

Sign In for Pricing
View Details
Prkca, NT (Prkca, Pkca, Protein kinase C alpha type) (MaxLight 405)
MBS6337308-02 5x 0.1 mL

Prkca, NT (Prkca, Pkca, Protein kinase C alpha type) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit Anti-HSF5 Polyclonal Antibody
PAV8023 100 μL

Rabbit Anti-HSF5 Polyclonal Antibody

Sign In for Pricing
View Details