Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF1B Rabbit Polyclonal Antibody (Biotin)

TAF1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik

UniProt

P97358

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-OHdG (DNA/RNA Damage) Mouse mAb, PE conjugated
orb3124779 100 µL

8-OHdG (DNA/RNA Damage) Mouse mAb, PE conjugated

Sign In for Pricing
View Details
Human DUSP7 Pre-designed siRNA Set B
SI004636B 1 Each

Human DUSP7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ppil3 Rabbit Polyclonal Antibody (HRP)
orb2110922 100 µL

Ppil3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
SNTB1 Protein Vector (Mouse) (pPB-C-His)
PV232382 500 ng

SNTB1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral mouse Hira shRNA (UAS) - Lentiviral mouse Hira shRNA (UAS, GFP) (100)
GTR15185001 1 Vial

Lentiviral mouse Hira shRNA (UAS) - Lentiviral mouse Hira shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ALPP (Alkaline Phosphatase, Placental Type, Alkaline Phosphatase Regan Isozyme, Placental Alkaline Phosphatase 1, PLAP-1, PLAP) (MaxLight 490)
MBS6369677-01 0.1 mL

ALPP (Alkaline Phosphatase, Placental Type, Alkaline Phosphatase Regan Isozyme, Placental Alkaline Phosphatase 1, PLAP-1, PLAP) (MaxLight 490)

Sign In for Pricing
View Details