Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf1b Rabbit Polyclonal Antibody (FITC)

Taf1b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik

UniProt

P97358

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Taf1b

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065639

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody
orb2958022-01 50 µg

MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody
orb2958022-02 100 µg

MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody
orb2958022-03 1 mg

MGluR1/5 (Group I) glutamate receptor Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Tissue cDNA, First Strand, Monkey (Cynomolgus) Adult Normal, Small Intestine, Duodenum, BioGenomicsTM
T5595-0534Q3 40 Tests

Tissue cDNA, First Strand, Monkey (Cynomolgus) Adult Normal, Small Intestine, Duodenum, BioGenomicsTM

Sign In for Pricing
View Details
FGFR3 beta (IIIc) [Biotin], His & Avi, Human
Z04091-100 100 µg

FGFR3 beta (IIIc) [Biotin], His & Avi, Human

Sign In for Pricing
View Details
ELMO1 Polyclonal Antibody
MBS8569518-01 0.1 mL

ELMO1 Polyclonal Antibody

Sign In for Pricing
View Details