Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mlxipl Rabbit Polyclonal Antibody (HRP)

Mlxipl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mlx, ChRE, WS-bH, Wbscr, ChREBP, bHLHd1, WS-bHLH, Wbscr14, bHLHd14

UniProt

Q99MZ3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Mlxipl

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VCGFVTPLQGSEADEHRKPEAVILEGNYWKRRIEVVMREYHKWRIYYKKR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSGA14 (CEP41) (NM_018718) Human Untagged Clone
SC102336 10 µg

TSGA14 (CEP41) (NM_018718) Human Untagged Clone

Sign In for Pricing
View Details
NALCN Antibody, FITC conjugated
CSB-PA815590LC01HU-01 50 µg

NALCN Antibody, FITC conjugated

Sign In for Pricing
View Details
NALCN Antibody, FITC conjugated
CSB-PA815590LC01HU-02 100 µg

NALCN Antibody, FITC conjugated

Sign In for Pricing
View Details
OR11J5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
34939061 1.0 µg DNA

OR11J5P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Olr1543 (NM_001001104) Rat Tagged Lenti ORF Clone
RR206906L3 10 µg

Olr1543 (NM_001001104) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken CD4 ELISA Kit
ECKC0011 96 Tests

Chicken CD4 ELISA Kit

Sign In for Pricing
View Details