Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRIP2 Rabbit Polyclonal Antibody (FITC)

NRIP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NI, NIX1, AW491344

UniProt

Q14BZ2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NRIP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068363

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7489706 1.0 µg DNA

Yars sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
IGFBPL1 Rabbit pAb, AE conjugated
orb2887044 100 µL

IGFBPL1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
KIAA1530 Protein Lysate (Human) with C-Ha Tag
25622031 100 µg

KIAA1530 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-MINPP1 Antibody Picoband® Fluoro550 Conjugated
A08462-3-Fluoro550 100 µg/Vial

Anti-MINPP1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
PCDH20 (Protocadherin 20, FLJ22218, PCDH13) (MaxLight 405) discontinued
249829-ML405 100 µL

PCDH20 (Protocadherin 20, FLJ22218, PCDH13) (MaxLight 405) discontinued

Sign In for Pricing
View Details
USP36 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G3]
TA800095BM 100 µL

USP36 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G3]

Sign In for Pricing
View Details