Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRIP2 Rabbit Polyclonal Antibody (HRP)

NRIP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NI, NIX1, AW491344

UniProt

Q14BZ2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NRIP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_068363

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB3A2 Human qPCR Primer Pair (NM_054023)
HP216611 200 Reactions

SCGB3A2 Human qPCR Primer Pair (NM_054023)

Sign In for Pricing
View Details
XRCC6 (X-ray Repair Cross-complementing Protein 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (FITC)
MBS6443604-01 0.1 mL

XRCC6 (X-ray Repair Cross-complementing Protein 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (FITC)

Sign In for Pricing
View Details
XRCC6 (X-ray Repair Cross-complementing Protein 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (FITC)
MBS6443604-02 5x 0.1 mL

XRCC6 (X-ray Repair Cross-complementing Protein 6, CTC75, CTCBF, G22P1, KU70, ML8, TLAA) (FITC)

Sign In for Pricing
View Details
APC Anti-human CD111 Antibody *R1.302*
111101B2-AAT 500 Tests

APC Anti-human CD111 Antibody *R1.302*

Sign In for Pricing
View Details
Ints12 3'UTR GFP Stable Cell Line
TU256329 1.0 mL

Ints12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rickettsia rickettsii RT PCR kit
RTq-V093-50D 50T

Rickettsia rickettsii RT PCR kit

Sign In for Pricing
View Details