Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jarid2 Rabbit Polyclonal Antibody (FITC)

Jarid2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Jmj, jumo, jumonji

UniProt

Q62315

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

137kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey IgG (Rhesus, non-immune, isotype control), purified
20012-10 10 mg

Monkey IgG (Rhesus, non-immune, isotype control), purified

Sign In for Pricing
View Details
Vmn1r234 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3141705 3x 1.0 µg

Vmn1r234 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CCDC59 Polyclonal Antibody
A67766-020 20 µL

CCDC59 Polyclonal Antibody

Sign In for Pricing
View Details
Sema5a, NT (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (APC)
MBS6498715-01 0.2 mL

Sema5a, NT (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (APC)

Sign In for Pricing
View Details
Sema5a, NT (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (APC)
MBS6498715-02 5x 0.2 mL

Sema5a, NT (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (APC)

Sign In for Pricing
View Details
Recombinant Human CTLA 4 Protein, His, E.coli-25ug
QP11555-25ug 25ug

Recombinant Human CTLA 4 Protein, His, E.coli-25ug

Sign In for Pricing
View Details