Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jarid2 Rabbit Polyclonal Antibody (HRP)

Jarid2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Jmj, jumo, jumonji

UniProt

Q62315

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

137kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD21 Antibody - middle region : Biotin (ARP54467_P050-Biotin)
ARP54467_P050-Biotin 100 µL

KCTD21 Antibody - middle region : Biotin (ARP54467_P050-Biotin)

Sign In for Pricing
View Details
Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit
MBS2157728-01 96 Tests

Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit
MBS2157728-02 5x 96 Tests

Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit
MBS2157728-03 10x 96 Tests

Defensin Alpha 1, Neutrophil (DEFa1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit anti-S6K1 Antibody
MBS4512535-01 0.05 mL

Rabbit anti-S6K1 Antibody

Sign In for Pricing
View Details
Rabbit anti-S6K1 Antibody
MBS4512535-02 0.1 mL

Rabbit anti-S6K1 Antibody

Sign In for Pricing
View Details