Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jarid2 Rabbit Polyclonal Antibody (Biotin)

Jarid2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Jmj, jumo, jumonji

UniProt

Q62315

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

137kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F122A Antibody
57-417 400 µL

F122A Antibody

Sign In for Pricing
View Details
RASA1, CT (RASA1, RASA, Ras GTPase-activating protein 1, Ras p21 protein activator, p120GAP) (AP) discontinued
040842-AP 200 µL

RASA1, CT (RASA1, RASA, Ras GTPase-activating protein 1, Ras p21 protein activator, p120GAP) (AP) discontinued

Sign In for Pricing
View Details
Integrin alpha E (ITGAE) Human shRNA Lentiviral Particle (Locus ID 3682)
TL312088V 500 µL Each

Integrin alpha E (ITGAE) Human shRNA Lentiviral Particle (Locus ID 3682)

Sign In for Pricing
View Details
5'-TET-Oligo d (T) 16; 25 ug
26-4916-02 25 µg

5'-TET-Oligo d (T) 16; 25 ug

Sign In for Pricing
View Details
Osbpl2 ORF Vector (Rat) (pORF)
ORF072964 1.0 µg DNA

Osbpl2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
REA (PHB2) (NM_001267700) Human Tagged ORF Clone
RG233580 10 µg

REA (PHB2) (NM_001267700) Human Tagged ORF Clone

Sign In for Pricing
View Details