Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSG101 Rabbit Polyclonal Antibody (FITC)

TSG101 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CC2, AI255943

UniProt

Q61187

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_068684

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human LILRB4 Antibody, Dylight594 Conjugate
DZ41337-Dylight594 200 µL

Anti-Human LILRB4 Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details
PRKRA (S246) (Interferon-inducible Double Stranded RNA-dependent Protein Kinase Activator A, Protein Kinase, Interferon-inducible Double Stranded RNA-dependent Activator, Protein Activator Of The Interferon-induced Protein Kinase, PKR-associated Protein X, PKR-associating Protein X, HSD14, HSD-14, PACT, RAX) (AP) discontinued
P9104-92H-AP 200 µL

PRKRA (S246) (Interferon-inducible Double Stranded RNA-dependent Protein Kinase Activator A, Protein Kinase, Interferon-inducible Double Stranded RNA-dependent Activator, Protein Activator Of The Interferon-induced Protein Kinase, PKR-associated Protein X, PKR-associating Protein X, HSD14, HSD-14, PACT, RAX) (AP) discontinued

Sign In for Pricing
View Details
Rat Free Erythrocyte Proloporphyrin FEP ELISA Kit
BG-RAT10986 1 Each

Rat Free Erythrocyte Proloporphyrin FEP ELISA Kit

Sign In for Pricing
View Details
RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 650) discontinued
040913-ML650 100 µL

RBPJ, NT (RBPJ, IGKJRB, IGKJRB1, RBPJK, RBPSUH, Recombining binding protein suppressor of hairless, CBF-1, J kappa-recombination signal-binding protein, RBP-J kappa, Renal carcinoma antigen NY-REN-30) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SNAR-H sgRNA CRISPR Lentivector set (Human)
K2209201 3x 1.0 µg

SNAR-H sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Sulfapyridine-d4
466614-01 1 mg

Sulfapyridine-d4

Sign In for Pricing
View Details