Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYCARD Rabbit Polyclonal Antibody (Biotin)

PYCARD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

A, Asc, TMS-, TNS1, masc, CARD5, TMS-1, 9130417A21Rik

UniProt

Q9EPB4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse PYCARD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVLRDMGLQELAEQLQTTKEESGAVAAAASVPAQSTARTGHFVDQHRQAL

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_075747

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody (PE-Cy7)
orb901388 100 µL

Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
TRIM60P14 3'UTR GFP Stable Cell Line
TU076584 1.0 mL

TRIM60P14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
EGLN3, CT (EGLN3, Egl nine homolog 3, HPH-1, Hypoxia-inducible factor prolyl hydroxylase 3, Prolyl hydroxylase domain-containing protein 3) (MaxLight 550) discontinued
034972-ML550 100 µL

EGLN3, CT (EGLN3, Egl nine homolog 3, HPH-1, Hypoxia-inducible factor prolyl hydroxylase 3, Prolyl hydroxylase domain-containing protein 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)
MBS2078876-01 0.1 mL

HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)
MBS2078876-02 0.2 mL

HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)
MBS2078876-03 0.5 mL

HRP-Linked Polyclonal Antibody to Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1)

Sign In for Pricing
View Details