Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan14 Rabbit Polyclonal Antibody (Biotin)

Zkscan14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Zfp9, Zfp99, Znf394, 2310046C23Rik, 2810437E14Rik

UniProt

Q9Z1D9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVKPHSSVDSAVGLLETQRQFQEDKPYKCDSCEKGFRQRSDLFKHQRIHT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_075811

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2)
MBS6006469-01 0.1 mg

OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2)

Sign In for Pricing
View Details
OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2)
MBS6006469-02 5x 0.1 mg

OBFC1 (STN1, CST Complex Subunit STN1, Oligonucleotide/Oligosaccharide-binding Fold-containing Protein 1, Suppressor of cdc Thirteen Homolog, FLJ22559, RP11-541N10.2, RPA-32, BA541N10.2, AAF44, AAF-44, bA541N10.2)

Sign In for Pricing
View Details
CNN1 Antibody
A74786-100UL 100 µL

CNN1 Antibody

Sign In for Pricing
View Details
P120 Catenin
HAR062-6ml 6 mL

P120 Catenin

Sign In for Pricing
View Details
Recombinant Brucella Canis uxaC Protein (aa 1-466)
VAng-Lsx5369-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Canis uxaC Protein (aa 1-466)

Sign In for Pricing
View Details
SNX1 Polyclonal Antibody, RBITC Conjugated
bs-2945R-RBITC 100 µL

SNX1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details