Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELP4 Rabbit Polyclonal Antibody (Biotin)

ELP4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pax, Paxneb, A330107A17Rik

UniProt

Q9ER73

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse ELP4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QKSVYAEGFDGANPQKKQKNILRIGIQNLGSPLWGDDICCKENCDNNHRL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076365

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLADQA1 (HLA-DQA1) (NM_002122) Human Over-expression Lysate
LS003117-20ug 20 µg

HLADQA1 (HLA-DQA1) (NM_002122) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MCEE Recombinant Protein
PROTQ96PE7-100ug 100 µg

Human MCEE Recombinant Protein

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (APC)
MBS6188032-01 0.1 mL

TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (APC)

Sign In for Pricing
View Details
TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (APC)
MBS6188032-02 5x 0.1 mL

TGFB1 (Transforming Growth Factor beta1, Camurati Engelmann Disease, CED, DPD1, TGFB, TGF-beta, TGF-beta1) (APC)

Sign In for Pricing
View Details
Bovine Acidic Fibroblast Growth Factor ELISA Kit
OM621837 96 Strip Well

Bovine Acidic Fibroblast Growth Factor ELISA Kit

Sign In for Pricing
View Details
MYT1 Protein Vector (Mouse) (pPB-N-His)
PV203791 500 ng

MYT1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details