Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXI1 Rabbit Polyclonal Antibody (HRP)

FOXI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hfh3, Fkh10, HFH-3, FREAC6, 5830401E05Rik

UniProt

Q922I5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse FOXI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIGQEPPEMNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWFNGP

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAD, phosphorylated (S91) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (APC) discontinued
032406-APC 200 µL

BAD, phosphorylated (S91) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Canine Leptin (LEP)
AP7F512 100 µg

Recombinant Canine Leptin (LEP)

Sign In for Pricing
View Details
Zinc finger protein basonuclin-1 (BNC1) Human ELISA Kit
I4002 96 Tests

Zinc finger protein basonuclin-1 (BNC1) Human ELISA Kit

Sign In for Pricing
View Details
PLAC1 Recombinant Protein (Mouse)
RP162578 100 µg

PLAC1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
AKT Blocking Peptide
MBS8244192-01 1 mg

AKT Blocking Peptide

Sign In for Pricing
View Details
AKT Blocking Peptide
MBS8244192-02 5 mg

AKT Blocking Peptide

Sign In for Pricing
View Details