Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tsc22d4 Rabbit Polyclonal Antibody (Biotin)

Tsc22d4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tilz2, Thg-1p, AI415410, Thg-1pit, 0610009M14Rik, 1700023B23Rik

UniProt

Q99PD5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076399

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TSG6/TNFAIP6 Antibody Picoband® (iFluor647 Conjugate)
A03433-1-iFluor647 100 µg

Anti-TSG6/TNFAIP6 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)
MBS2103355-01 5x 96 Tests

Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)
MBS2103355-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)
MBS2103355-03 10x 96 Tests

Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)
MBS2103355-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Endothelin Converting Enzyme 2 (ECE2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
CC2D1A Antibody
orb1257643 100 µL

CC2D1A Antibody

Sign In for Pricing
View Details