Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sra1 Rabbit Polyclonal Antibody (FITC)

Sra1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Sra, Srap, Straa1, Strra1, AA959952

UniProt

Q80VJ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS1 Human Gene Knockout Kit (CRISPR)
KN224804LP 1 Kit

GAS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBE2S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B8]
TA505169BM 100 µL

UBE2S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B8]

Sign In for Pricing
View Details
TAQuest™ qPCR Master Mix with Helixyte™ Green *No ROX*
17270-AAT 1 mL

TAQuest™ qPCR Master Mix with Helixyte™ Green *No ROX*

Sign In for Pricing
View Details
Vasopressin (AVP) Rabbit Polyclonal Antibody
20069 100 µL

Vasopressin (AVP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
11Beta-Hydroperoxy Dienogest
TRC-H914685-1MG 1 mg

11Beta-Hydroperoxy Dienogest

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF640R conjugate, 0.1mg/mL
BNC401747-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1747R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details