Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sra1 Rabbit Polyclonal Antibody (HRP)

Sra1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sra, Srap, Straa1, Strra1, AA959952

UniProt

Q80VJ2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMRCPAGGAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQTGGPKRTPLT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079567

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAM2 Polyclonal Antibody
E-AB-90100-01 60 µL

ADAM2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM2 Polyclonal Antibody
E-AB-90100-02 120 µL

ADAM2 Polyclonal Antibody

Sign In for Pricing
View Details
ADAM2 Polyclonal Antibody
E-AB-90100-03 200 µL

ADAM2 Polyclonal Antibody

Sign In for Pricing
View Details
3D Gyratory Rocker BTUR-304
BTUR-304 1 Unit

3D Gyratory Rocker BTUR-304

Sign In for Pricing
View Details
Cytokeratin, multi (KRT/457), CF488A conjugate, 0.1mg/mL
BNC880457-500 1x 500 µL

Cytokeratin, multi (KRT/457), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EZH2 / KMT6 (EZH2/2536), Biotin conjugate, 0.1mg/mL
BNCB2536-500 1x 500 µL

EZH2 / KMT6 (EZH2/2536), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details