Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plbd1 Rabbit Polyclonal Antibody (Biotin)

Plbd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

1100001H23Rik

UniProt

Q8VCI0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ESKKVEIKTVLDKNGDAYGYYNDSIKTTGWGILEIRAGYGSQVLSNEIIM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080082

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTAP Antibody
orb3162147-01 50 µL

MTAP Antibody

Sign In for Pricing
View Details
MTAP Antibody
orb3162147-02 100 µL

MTAP Antibody

Sign In for Pricing
View Details
Interferon gamma (IFG, IFI, IFN Gamma, IFN Immune, IFN, immune, IFN-gamma, IFNG, IFNG_HUMAN, Immune Interferon, Interferon Gamma Precursor, Macrophage Activating Factor, MAF, T Cell Interferon, Type II Interferon) (Biotin) discontinued
303393-Biotin 100 µL

Interferon gamma (IFG, IFI, IFN Gamma, IFN Immune, IFN, immune, IFN-gamma, IFNG, IFNG_HUMAN, Immune Interferon, Interferon Gamma Precursor, Macrophage Activating Factor, MAF, T Cell Interferon, Type II Interferon) (Biotin) discontinued

Sign In for Pricing
View Details
PSMD12 (26S Proteasome Non-ATPase Regulatory Subunit 12, p55, Rpn5) discontinued
219171-01 20 µL

PSMD12 (26S Proteasome Non-ATPase Regulatory Subunit 12, p55, Rpn5) discontinued

Sign In for Pricing
View Details
PSMD12 (26S Proteasome Non-ATPase Regulatory Subunit 12, p55, Rpn5) discontinued
219171-02 100 µL

PSMD12 (26S Proteasome Non-ATPase Regulatory Subunit 12, p55, Rpn5) discontinued

Sign In for Pricing
View Details
Ethyl 2,3,4,6-tetra-O-benzyl-β-D-thiogalactopyranoside
TSW-00090-01 100 mg

Ethyl 2,3,4,6-tetra-O-benzyl-β-D-thiogalactopyranoside

Sign In for Pricing
View Details