Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Use1 Rabbit Polyclonal Antibody (FITC)

Use1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

D12, Ed2, Q-S, p31, Q-snare, AV002165, 2010315L10Rik, 5730403H22Rik

UniProt

Q9CQ56

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2010315L10RIK

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_080193

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Thrombopoietin/THPO Antibody (MM0566-1Z3) [FITC]
NBP2-11922F 0.1 mL

Mouse Monoclonal Thrombopoietin/THPO Antibody (MM0566-1Z3) [FITC]

Sign In for Pricing
View Details
Phospho-GSK3A (Ser21) Rabbit Polyclonal Antibody (BF350)
orb2415920 100 µL

Phospho-GSK3A (Ser21) Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae gcvT Protein (aa 1-367) (strain Br4923)
VAng-Yyj1966-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Leprae gcvT Protein (aa 1-367) (strain Br4923)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)
MBS7037940-01 0.02 mg

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)
MBS7037940-02 0.1 mg

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

Sign In for Pricing
View Details
Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)
MBS7037940-03 5x 0.1 mg

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

Sign In for Pricing
View Details