Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASS4 Rabbit Polyclonal Antibody (FITC)

LASS4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

L, Cer, Trh, Trh1, Lass4, 2900019C14Rik

UniProt

Q9D6J1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVAVRIVFERFVALPLSRWMGVQDPIRRKIKPNPVLEKYFLRMKQCPEET

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_080334

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIRC5 (Baculoviral IAP Repeat-containing Protein 5, API4, EPR-1) (APC)
MBS6408589-01 0.1 mL

BIRC5 (Baculoviral IAP Repeat-containing Protein 5, API4, EPR-1) (APC)

Sign In for Pricing
View Details
BIRC5 (Baculoviral IAP Repeat-containing Protein 5, API4, EPR-1) (APC)
MBS6408589-02 5x 0.1 mL

BIRC5 (Baculoviral IAP Repeat-containing Protein 5, API4, EPR-1) (APC)

Sign In for Pricing
View Details
RWDD1 siRNA (Mouse)
MBS8239206-01 15 nmol

RWDD1 siRNA (Mouse)

Sign In for Pricing
View Details
RWDD1 siRNA (Mouse)
MBS8239206-02 30 nmol

RWDD1 siRNA (Mouse)

Sign In for Pricing
View Details
RWDD1 siRNA (Mouse)
MBS8239206-03 5x 30 nmol

RWDD1 siRNA (Mouse)

Sign In for Pricing
View Details
SRBD1, CT (SRBD1, S1 RNA-binding domain-containing protein 1) (MaxLight 550)
MBS6351044-01 0.1 mL

SRBD1, CT (SRBD1, S1 RNA-binding domain-containing protein 1) (MaxLight 550)

Sign In for Pricing
View Details