Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bola1 Rabbit Polyclonal Antibody (Biotin)

Bola1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

1810037G04Rik

UniProt

Q9D8S9

Immunogen

The immunogen is a synthetic peptide directed towards the n terminal region of mouse Bola1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APG8b, NT (T29) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associ
MBS6274303-01 0.2 mL

APG8b, NT (T29) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associ

Sign In for Pricing
View Details
APG8b, NT (T29) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associ
MBS6274303-02 5x 0.2 mL

APG8b, NT (T29) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associ

Sign In for Pricing
View Details
Anti-CNDP2 Polyclonal Antibody
HV578024-01 50 µg

Anti-CNDP2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CNDP2 Polyclonal Antibody
HV578024-02 100 µg

Anti-CNDP2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem I reaction center subunit IV (psaE)
MBS1237695-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Photosystem I reaction center subunit IV (psaE)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem I reaction center subunit IV (psaE)
MBS1237695-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Photosystem I reaction center subunit IV (psaE)

Sign In for Pricing
View Details