Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISL2 Rabbit Polyclonal Antibody (HRP)

ISL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Isle, 3110001N10Rik

UniProt

Q9CXV0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081673

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PIGL shRNA (UAS) - Lentiviral human PIGL shRNA (UAS) (100)
GTR15314457 1 Vial

Lentiviral human PIGL shRNA (UAS) - Lentiviral human PIGL shRNA (UAS) (100)

Sign In for Pricing
View Details
HERC1 Rabbit Polyclonal Antibody (Cy3)
orb984925 100 µL

HERC1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
LYAR (NM_001145725) Human Untagged Clone
SC326467 10 µg

LYAR (NM_001145725) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Akirin2 (NM_001007589) AAV Particle
MR219891A1V 250 µL

Mouse Akirin2 (NM_001007589) AAV Particle

Sign In for Pricing
View Details
Mouse adrencocorticotropic hormone (ACTH) Elisa Kit
EK730019 96 Well

Mouse adrencocorticotropic hormone (ACTH) Elisa Kit

Sign In for Pricing
View Details
VDR Antibody
CSB-PA060063-01 50 µg

VDR Antibody

Sign In for Pricing
View Details