Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSFY2 Rabbit Polyclonal Antibody (FITC)

HSFY2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Hspy2l, 4933413G11Rik

UniProt

Q80Y37

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_081937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Distal-Less Homeobox 3 (DLX3) Antibody
abx331585 100 µL

Distal-Less Homeobox 3 (DLX3) Antibody

Sign In for Pricing
View Details
Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit
MBS7215351-01 48 Well

Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit

Sign In for Pricing
View Details
Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit
MBS7215351-02 96 Well

Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit

Sign In for Pricing
View Details
Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit
MBS7215351-03 5x 96 Well

Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit

Sign In for Pricing
View Details
Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit
MBS7215351-04 10x 96 Well

Mouse AT-rich interactive domain-containing protein 3C (ARID3C) ELISA Kit

Sign In for Pricing
View Details
Mrpl23 Rat siRNA Oligo Duplex (Locus ID 64360)
SR514799 1 Kit

Mrpl23 Rat siRNA Oligo Duplex (Locus ID 64360)

Sign In for Pricing
View Details