Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSFY2 Rabbit Polyclonal Antibody (HRP)

HSFY2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hspy2l, 4933413G11Rik

UniProt

Q80Y37

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_081937

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-1 alpha Rabbit Polyclonal Antibody
ER1802-36 100 µL

IL-1 alpha Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human UBE2W activation kit by CRISPRa
GA110672 1 Kit

Human UBE2W activation kit by CRISPRa

Sign In for Pricing
View Details
PNLIPRP3 (N-term) Rabbit Polyclonal Antibody
AP53367PU-N 400 µL

PNLIPRP3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WBS28 (WBSCR28) (NM_182504) Human Recombinant Protein
TP305458L 1 mg

WBS28 (WBSCR28) (NM_182504) Human Recombinant Protein

Sign In for Pricing
View Details
PGP9.5 Antibody
OC-135-01 50 μL

PGP9.5 Antibody

Sign In for Pricing
View Details
PGP9.5 Antibody
OC-135-02 100 µL

PGP9.5 Antibody

Sign In for Pricing
View Details