Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dmrtc2 Rabbit Polyclonal Antibody (FITC)

Dmrtc2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Dmrt, Dmrt7, 4933432E21Rik

UniProt

Q8CGW9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dmrtc2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human SESN2 pAb
PA7831-01 50 μL

Rabbit Anti-Human SESN2 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human SESN2 pAb
PA7831-02 100 μL

Rabbit Anti-Human SESN2 pAb

Sign In for Pricing
View Details
Cow TNF Receptor Superfamily Member 5 / TNFRSF5 (CD40) ELISA Kit
abx520982 96 Tests

Cow TNF Receptor Superfamily Member 5 / TNFRSF5 (CD40) ELISA Kit

Sign In for Pricing
View Details
Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)
MBS1484187-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)
MBS1484187-02 0.02 mg (Yeast)

Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)
MBS1484187-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis Centromere protein N-A (cenpn-a)

Sign In for Pricing
View Details