Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ddx54 Rabbit Polyclonal Antibody (Biotin)

Ddx54 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP, DP9, DP97, AI414901, 2410015A15Rik

UniProt

Q8K4L0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYPD1, CT (LYPD1, LYPDC1, Ly6/PLAUR domain-containing protein 1, Putative HeLa tumor suppressor) (MaxLight 405)
MBS6317686-01 0.1 mL

LYPD1, CT (LYPD1, LYPDC1, Ly6/PLAUR domain-containing protein 1, Putative HeLa tumor suppressor) (MaxLight 405)

Sign In for Pricing
View Details
LYPD1, CT (LYPD1, LYPDC1, Ly6/PLAUR domain-containing protein 1, Putative HeLa tumor suppressor) (MaxLight 405)
MBS6317686-02 5x 0.1 mL

LYPD1, CT (LYPD1, LYPDC1, Ly6/PLAUR domain-containing protein 1, Putative HeLa tumor suppressor) (MaxLight 405)

Sign In for Pricing
View Details
VDAC3 Rabbit pAb
orb2709211-01 50 µL

VDAC3 Rabbit pAb

Sign In for Pricing
View Details
VDAC3 Rabbit pAb
orb2709211-02 100 µL

VDAC3 Rabbit pAb

Sign In for Pricing
View Details
Procalcitonin (PCT) Canine ELISA Kit
C1080 96 Tests

Procalcitonin (PCT) Canine ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000)
MBS1164950-01 0.02 mg (E-Coli)

Recombinant Mycobacterium ulcerans Trans-acting enoyl reductase (MUL_2000)

Sign In for Pricing
View Details