Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp444 Rabbit Polyclonal Antibody (HRP)

Zfp444 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MFLJ00134, 2810031J10Rik, 6230401O10Rik

UniProt

Q3TDV8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFACWECGKGFGRREHVLRHQRIHGRAAAVAQGTSAPGPEGGGAFPPWAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_082592

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1 (NM_004035) Human Tagged ORF Clone Lentiviral Particle
RC200230L3V 200 µL

ACOX1 (NM_004035) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
S-Sulfo-L-cysteine Sodium Salt (~85%)
TRC-S789483-100MG 100 mg

S-Sulfo-L-cysteine Sodium Salt (~85%)

Sign In for Pricing
View Details
Polyclonal Antibody to Delta Like Protein 4 (dLL4)
MBS2005913-01 0.1 mL

Polyclonal Antibody to Delta Like Protein 4 (dLL4)

Sign In for Pricing
View Details
Polyclonal Antibody to Delta Like Protein 4 (dLL4)
MBS2005913-02 0.2 mL

Polyclonal Antibody to Delta Like Protein 4 (dLL4)

Sign In for Pricing
View Details
Polyclonal Antibody to Delta Like Protein 4 (dLL4)
MBS2005913-03 0.5 mL

Polyclonal Antibody to Delta Like Protein 4 (dLL4)

Sign In for Pricing
View Details
Polyclonal Antibody to Delta Like Protein 4 (dLL4)
MBS2005913-04 1 mL

Polyclonal Antibody to Delta Like Protein 4 (dLL4)

Sign In for Pricing
View Details