Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC19 Rabbit Polyclonal Antibody (HRP)

TTC19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI505442, 2010204O13Rik, 2810460C24Rik

UniProt

Q5NCZ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse TTC19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_082636

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPAL1 CRISPR Activation Plasmid (m2)
sc-427780-ACT-2 20 µg

NPAL1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri ISCX Polyclonal Antibody
MBS7166714 Inquire

Rabbit anti-Shigella flexneri ISCX Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse RBM27 (KIAA1311), Rabbit Polyclonal
MKA1311 Inquire

Anti-Mouse RBM27 (KIAA1311), Rabbit Polyclonal

Sign In for Pricing
View Details
TRNT1 Human qPCR Primer Pair (NM_182916)
HP228567 200 Reactions

TRNT1 Human qPCR Primer Pair (NM_182916)

Sign In for Pricing
View Details
TTC 1% Supplement
6030 Pack 10 Vials (1 Vial / 500 mL of Medium)

TTC 1% Supplement

Sign In for Pricing
View Details
Kaempferol 3,7,4'-trimethyl ether
AB3178 20 mg

Kaempferol 3,7,4'-trimethyl ether

Sign In for Pricing
View Details