Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARN Rabbit Polyclonal Antibody (HRP)

PARN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D, DAN, 1200003I18Rik

UniProt

Q8VDG3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEEADFFAIDGEFSGISNGPSVTALTSGFDTPEERYQKLKKHSMDFLLFQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083037

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF2/BMP9 Mouse Monoclonal Antibody (PerCP)
orb2971492-01 50 Tests

GDF2/BMP9 Mouse Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
GDF2/BMP9 Mouse Monoclonal Antibody (PerCP)
orb2971492-02 100 Tests

GDF2/BMP9 Mouse Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details
Calmodulin-Dependent Protein Kinase II (281 - 289)
M41235-01 100 mg

Calmodulin-Dependent Protein Kinase II (281 - 289)

Sign In for Pricing
View Details
Calmodulin-Dependent Protein Kinase II (281 - 289)
M41235-02 25 mg

Calmodulin-Dependent Protein Kinase II (281 - 289)

Sign In for Pricing
View Details
Calmodulin-Dependent Protein Kinase II (281 - 289)
M41235-03 50 mg

Calmodulin-Dependent Protein Kinase II (281 - 289)

Sign In for Pricing
View Details
Calmodulin-Dependent Protein Kinase II (281 - 289)
M41235-04 500 mg

Calmodulin-Dependent Protein Kinase II (281 - 289)

Sign In for Pricing
View Details