Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXP4 Rabbit Polyclonal Antibody (FITC)

FOXP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MFKHLA, 1200010K03Rik, 2310007G05Rik

UniProt

Q9DBY0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm14322 AAV Vector (Mouse) (CMV)
21840104 1 µg

Gm14322 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Ddx3y 3'UTR Lenti-reporter-Luc Vector
17837084 1.0 µg

Ddx3y 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit
MBS7226259-01 48 Well

Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit
MBS7226259-02 96 Well

Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit
MBS7226259-03 5x 96 Well

Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit

Sign In for Pricing
View Details
Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit
MBS7226259-04 10x 96 Well

Sheep Cytochrome P450 1A2 (CYP1A2) ELISA Kit

Sign In for Pricing
View Details