Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXP4 Rabbit Polyclonal Antibody (HRP)

FOXP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MFKHLA, 1200010K03Rik, 2310007G05Rik

UniProt

Q9DBY0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_083043

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FAM161A Protein
E30P6430 20 µg

Recombinant Human FAM161A Protein

Sign In for Pricing
View Details
Human MCHR2 full length protein-synthetic nanodisc
E33F100348 10 µg

Human MCHR2 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Olfr716 3'UTR Luciferase Stable Cell Line
TU115453 1.0 mL

Olfr716 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GENLISA™ Porcine Epidermal Growth Factor (EGF) ELISA
KLP0556 1x 96 Well

GENLISA™ Porcine Epidermal Growth Factor (EGF) ELISA

Sign In for Pricing
View Details
L(+)-Homoarginine hydrochloride
MBS3608043-01 100 mg

L(+)-Homoarginine hydrochloride

Sign In for Pricing
View Details
L(+)-Homoarginine hydrochloride
MBS3608043-02 5x 100 mg

L(+)-Homoarginine hydrochloride

Sign In for Pricing
View Details