Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf7l Rabbit Polyclonal Antibody (HRP)

Taf7l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Taf2, Taf2q, 4933438I11Rik

UniProt

Q9D3R9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Taf7l

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_083234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PERK (EIF2AK3) Rabbit Polyclonal Antibody
TA375790 100 µL

PERK (EIF2AK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF640R conjugate, 0.1mg/mL
BNC402183-500 1x 500 µL

Occludin (OCLN) (Tight Junctions Marker) (OCLN/2183), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Oxelumab Biosimilar - Dylight488 Research Grade
ICH5187D488-0.1mg 100 µg

Oxelumab Biosimilar - Dylight488 Research Grade

Sign In for Pricing
View Details
Betulinic Acid
TRC-B330250-5G 5 g

Betulinic Acid

Sign In for Pricing
View Details
Human CD62E Recombinant Rabbit monoclonal Antibody
HA723639B 100 µL

Human CD62E Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR559422 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details