Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF7L Rabbit Polyclonal Antibody (FITC)

TAF7L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Taf2, Taf2q, 4933438I11Rik

UniProt

Q99MW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_083234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal QN1 Antibody
NBP1-91156-25ul 25 µL

Rabbit Polyclonal QN1 Antibody

Sign In for Pricing
View Details
Recombinant Mouse SARS Protein, His (Fc)-Avi-tagged
SARS-7903M 50 µg

Recombinant Mouse SARS Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SKI Polyclonal Antibody
UB-GEN-6657 100 µL

SKI Polyclonal Antibody

Sign In for Pricing
View Details
BnaA07g20720D Rabbit Polyclonal Antibody (Fluoro488)
orb3088604 200 µL

BnaA07g20720D Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human JAK1 ELISA Kit (Ready to Use)
orb551248-01 48 Tests

Human JAK1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Human JAK1 ELISA Kit (Ready to Use)
orb551248-02 96 Tests

Human JAK1 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details