Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF7L Rabbit Polyclonal Antibody (HRP)

TAF7L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Taf2, Taf2q, 4933438I11Rik

UniProt

Q99MW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse TAF7L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DEDYGNEKEEEETDNSEEELEKELQAKFNEFSLHEADQDYSSITMAIQKL

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_083234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Navigator® Lysosome Staining Kit *Green Fluorescence with 405 nm Excitation*
22651-AAT 500 Tests

Cell Navigator® Lysosome Staining Kit *Green Fluorescence with 405 nm Excitation*

Sign In for Pricing
View Details
Claudin 4 (Ab-208) Antibody
8B8318-AAT 50 µg

Claudin 4 (Ab-208) Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
IL15 Antibody
KC-3541-01 50 μL

IL15 Antibody

Sign In for Pricing
View Details